PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538704.1_FGP038
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 293aa    MW: 32038.3 Da    PI: 8.1436
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538704.1_FGP038genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.77.5e-5651301128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdke+
  KN538704.1_FGP038   5 LPPGFRFHPTDEELVTYYLARKVSDFGFAT-RAITDVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDKEI 95 
                        79*************************999.89***************999999************************************** PP

                NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++ +g+l g+kktLvfy+grapkg kt+Wvmheyrl
  KN538704.1_FGP038  96 FH-GGALAGMKKTLVFYRGRAPKGAKTSWVMHEYRL 130
                        **.*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-653151IPR003441NAC domain
PROSITE profilePS5100560.3415151IPR003441NAC domain
PfamPF023653.8E-296130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEEGLPPGFR FHPTDEELVT YYLARKVSDF GFATRAITDV DLNKCEPWDL PSKASMGEKE  60
WYFFSMRDRK YPTGIRTNRA TDSGYWKTTG KDKEIFHGGA LAGMKKTLVF YRGRAPKGAK  120
TSWVMHEYRL QSKFPYKPAK DEWVVCRVFK KLQCHLAKPR PPHDDVDGDG ASPPEMVDAS  180
SLGELGELDV SSILLGGFAP PSGELCHGGG GGDGFGAHRL DVGAYMSWLQ AAAAANHGAG  240
IKQGCVSGHH VCLLTALHKG DRRLPADGVE GGMARAPGSY SAARRWIGSN EME
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-56515117165NO APICAL MERISTEM PROTEIN
1ut4_B2e-56515117165NO APICAL MERISTEM PROTEIN
1ut7_A2e-56515117165NO APICAL MERISTEM PROTEIN
1ut7_B2e-56515117165NO APICAL MERISTEM PROTEIN
4dul_A2e-56515117165NAC domain-containing protein 19
4dul_B2e-56515117165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0626750.0AK062675.1 Oryza sativa Japonica Group cDNA clone:001-105-G11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629240.11e-167PREDICTED: NAC domain-containing protein 59
SwissprotQ9FLR32e-77NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A0D3FLE71e-168A0A0D3FLE7_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g42630.11e-166(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.19e-92NAC domain containing protein 58